PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0718
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 170aa    MW: 19932.7 Da    PI: 10.2258
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0718genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.33.3e-1361118562
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  ++ rr+++NRe+ArrsR RK++ +e+L++ v +L  eN++L ++l  l  ++ +++++
  Gh_A12G0718  61 RKRRRMMSNRESARRSRMRKQKHLENLRNLVNQLRIENRELTSRLRFLLYHCHRVRTD 118
                  6789****************************************99888888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-1257121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.71459122IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-961134No hitNo description
SuperFamilySSF579591.69E-1061111No hitNo description
PfamPF001702.5E-1061117IPR004827Basic-leucine zipper domain
CDDcd147023.48E-1762113No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MLSTVPTMES LECDWDCSQL FSTIQSVGPA RSGSASSEPN QTHSNSGLDE SNLKLSIIEE  60
RKRRRMMSNR ESARRSRMRK QKHLENLRNL VNQLRIENRE LTSRLRFLLY HCHRVRTDND  120
SLRSEYTVLR QKLSDIQQIL LFKQLQQFSS TWPYNNVPVM SEQTPPPLII
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16064RKRRR
26081RKRRRMMSNRESARRSRMRKQK
37380RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437167.11e-119PREDICTED: basic leucine zipper 43-like
TrEMBLA0A0D2PQZ51e-119A0A0D2PQZ5_G
STRINGVIT_00s0541g00020.t013e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.13e-28basic leucine-zipper 5